Peptide Purity: | >99% |
---|---|
Delivery Time: | Within 24 Hours After Payment |
Arrival Time: | Around 12 Days |
Name: | Pnc-27 |
CAS Number: | 1159861-00-3 |
Molecular Formula: | C188h293n53o44s |
Samples: |
---|
Customization: |
---|
Suppliers with verified business licenses
CAS | 1159861-00-3 |
M.W/Mr. | 4029.2 |
Purity | 99% |
Sequence | PPLSQETFSDLWKLLKKWKMRRNQFWVKVQRG |
Product No. | Product |
45051511 | Semaglutide 5mg |
45051512 | Semaglutide 10mg |
45051513 | Semaglutide+Vitamin B12 |
45051514 | Semaglutide+Vitamin B6 |
45051515 | Semaglutide+L-Carnitine |
45051516 | Semaglutide cartridges 5mg |
45051517 | Semaglutide cartridges 10mg |
45051518 | Setmelanotide 20mg |
45051519 | Tirzepatide 5mg |
45051520 | Tirzepatide 10mg |
45051521 | Tirzepatide 15mg |
45051522 | Tirzepatide 20mg |
45051523 | Tirzepatide 30mg |
45051524 | Tirzepatide+Vitamin B12 |
45051525 | Liraglutide 10g |
45051526 | Retatrutide 8mg |
45051527 | Retatrutide 10mg |
45051528 | Retatrutide 12mg |
45051529 | Orforglipron 1g |
45051530 | Mazdutide 1g |
45051531 | NAD+ 500mg |
45051532 | NAD+ 750mg |
45051533 | NAD+ 1000mg |
45051534 | NMN 150mg |
45051538 | Adipotide/FTPP 10mg |
45051539 | α-Klotho (Alpha Klotho) 50µg |
45051541 | A960 5mg |
45051542 | ARA-290 16mg |
45051543 | 57 5mg |
45051544 | 57 10mg |
45051545 | B7-33 5mg |
45051546 | cAC-253 (Cyclic AC-253) 10mg |
45051549 | DSIP 5mg |
45051550 | DSIP 10mg |
45051551 | Epitalon 10mg |
45051552 | Epitalon 20mg |
45051553 | Epitalon 100mg |
45051554 | FG loop (FGL) 10mg |
45051556 | F344 1mg |
45051557 | FOXO4-DRI 10mg |
45051559 | GHK-Cu (Copper Peptide) 50mg |
45051560 | GHK-Cu (Copper Peptide) 100mg |
45051561 | G2 10mg |
45051562 | G6 10mg |
45051563 | Gona 10mg |
45051564 | HC5000 |
45051565 | Hexa 2mg |
45051566 | Hexa 5mg |
45051568 | Humanin 10mg |
45051573 | Ipam 5mg |
45051575 | Kisspeptin-10 5mg |
45051576 | Kisspeptin-10 10mg |
45051577 | KPV 5mg |
45051578 | KPV 10mg |
45051579 | LL-37 (CAP-18) 5mg |
45051580 | Melanotan 1 10mg |
45051581 | Melanotan 2 10mg |
45051582 | MOTS-c 5mg (acetate, TFA removed) |
45051583 | MOTS-c 10mg (acetate, TFA removed) |
45051584 | N-Acetyl Epitalon Amidate 10mg |
45051585 | N-Acetyl Selank Amidate 10mg |
45051586 | N-Acetyl Semax Amidate 30mg |
45051587 | Oxytocin 10mg |
45051588 | PNC-27 5mg |
45051590 | P21 (P021) 5mg |
45051591 | Selank 10mg |
45051592 | Semax 10mg |
45051593 | Sermo 2mg |
45051594 | Sermo 5mg |
45051595 | SS-31 40mg |
45051596 | Taltirelin 10mg |
45051597 | Tesam 2mg |
45051598 | Tesam 5mg |
45051600 | Thymalin 20mg (63958-90-7) |
45051601 | Thymosin Alpha-1 3mg |
45051602 | Thymosin Alpha-1 5mg |
45051603 | Thymosin Alpha-1 10mg |
45051604 | Thymosinb4 5mg |
45051605 | Thymosinb4 10mg |
45051607 | TP508 Thrombin Peptide 10mg |
45051608 | TRH Thyrotropin (Protirelin Acetate) 20mg |
45051609 | VIP (Vasoactive Intestinal Peptide) 6mg |
45051610 | Bronchogen (Bronchi) 20mg |
45051611 | Cardiogen (Myocardium) 20mg |
45051612 | Cartalax (Joints) 20mg |
45051613 | Chonluten (Respiratory organs) 20mg |
45051614 | Cortagen (Brain) 20mg |
45051615 | Crystagen (Immune system) 20mg |
45051616 | Livagen (Liver) 20mg |
45051617 | Pancragen (Pancreas) 20mg |
45051618 | Pinealon (Brain) 20mg |
45051619 | Prostamax (Prostate) 20mg |
45051620 | Testagen (Testes) 20mg |
45051621 | Vesugen (Blood vessels) 20mg |
45051622 | Vilon (Eye retina) 20mg |
45051623 | B15, T50 Blend 10mg |
ZB Bio has a long-standing track record in with successful registrations of highly purified synthetic peptide drugs of the glucagon family. Our regulatory intelligence keeps track of important changes in the relevant legislation. This enables us to be a leading global innovator in the field of glucagon and glucagon-like synthetic peptide drugs. Our services have been optimized to shorten timelines and of reduce complexity for our clients.
Suppliers with verified business licenses