High Purity Ll-37 5mg (CAP-18) CAS 154947-66-7 Raw Powder Peptide

Product Details
Customization: Available
CAS No.: 154947-66-7
Formula: C205h340n60o53
Still deciding? Get samples of $ !
Request Sample
Diamond Member Since 2023

Suppliers with verified business licenses

Audited Supplier

Audited by an independent third-party inspection agency

High Repeat Buyers Choice
More than 50% of buyers repeatedly choose the supplier
to see all verified strength labels (13)
  • High Purity Ll-37 5mg (CAP-18) CAS 154947-66-7 Raw Powder Peptide
  • High Purity Ll-37 5mg (CAP-18) CAS 154947-66-7 Raw Powder Peptide
  • High Purity Ll-37 5mg (CAP-18) CAS 154947-66-7 Raw Powder Peptide
  • High Purity Ll-37 5mg (CAP-18) CAS 154947-66-7 Raw Powder Peptide
  • High Purity Ll-37 5mg (CAP-18) CAS 154947-66-7 Raw Powder Peptide
  • High Purity Ll-37 5mg (CAP-18) CAS 154947-66-7 Raw Powder Peptide
Find Similar Products
  • Overview
  • Product Description
  • Main Products
  • Services
Overview

Basic Info.

Model NO.
ZZB
EINECS
/
Type
Lyophilized Powder
Appearance
Powder
Quality
Pharmaceutical Grade
Colour
White
Purity HPLC
≥99.0%
Sequence
[LL-37, 37 aa]
Molecular Weight
4 493.4
Storage
-20°c, Protect From Light, Dry, Sealed
Transport Package
Vials/Tubes/Bottles
Specification
5mg
Trademark
ZB
Origin
China
Production Capacity
100, 000 Vials Per Week

Product Description

Product Description

What is LL 37?

LL 37 peptide,
also known as CAP-18 for Cathelicidin antimicrobial peptide 18, is a 37 amino acid cationic peptide.LL 37 is also a typical linear antimicrobial peptide which can eliminate a wide range of pathogenes, including bacteria, viruses, fungi, and parasitesCAP-18 is the only human cathelicidin peptide reported yet, found in lysosomes of macrophages and leukocytes.
High Purity Ll-37 5mg (CAP-18) CAS 154947-66-7 Raw Powder Peptide

LL 37- Technical SpecificationHigh Purity Ll-37 5mg (CAP-18) CAS 154947-66-7 Raw Powder Peptide

  Sequence : [LL-37, 37 aa]
  MW : 4 493.4 Da (C205H340N60O53)
  Purity : > 99%
  Other names : Cathelicidin,154947-66-7, All38 peptide, BAC4, CAP18, CAMP, 
  Peptide Solubility Guideline
  Bulk peptide quantities available
 

What is the Benefit of LI 37 Peptide?

1. Immune Support
2. Antimicrobial Properties
3. Wound Healing
4. Anti-inflammatory Effects
5. Angiogenesis Promotion 
6. Anti-tumor Potential
7. Skin Health
8. Neuroprotective Effects
High Purity Ll-37 5mg (CAP-18) CAS 154947-66-7 Raw Powder Peptide

 
Main Products

High Purity Ll-37 5mg (CAP-18) CAS 154947-66-7 Raw Powder PeptideGENERIC PEPTIDES (GMP)

High Purity Ll-37 5mg (CAP-18) CAS 154947-66-7 Raw Powder Peptide
Services

 

cGMP peptides Manufacturing

Zhaobo Bio acquired early mastery of development and manufacturing of peptides, the short chain amino acids linked by peptide bonds that have enabled new generations of small molecule drugs that closely mimic the body's natural pathways.
Now Zhaobo Bio possesses first-class capabilities to manufacture peptides at industrial scale and in full compliance with the strictest Good Manufacturing Practice (cGMP) standards.


Upstream peptide synthesis
Zhaobo Bio production plants are endowed with state-of-the-art equipment for solvent supply, peptide synthesis, purification and isolation of active ingredients and intermediates. All equipment and containment is GMP qualified and cleaning validated. Overlapping capacities and sizes of different equipment trains facilitate a smooth scale-up for increases in demand within the product life cycle. 

Downstream purification and isolation of peptides
Zhaobo Bio is committed to the systematic expansion and modernization of its purification equipment in order to ensure the efficient production of ever-increasing amounts of bulk peptide pharmaceuticals.
It uses sophisticated methods for large scale purification campaigns such as preparative high performance liquid chromatography (HPLC), ion exchange (IEX), size-exclusion chromatography (SEC), and ultra-filtration (UF/TFF). The equipment in place permits highly efficient or even continuous manufacturing of extremely pure products up to multi-kg quantities per lot.
For preparative HPLC, dynamic axial compression (DAC) stainless steel columns of up to 60 cm diameter both in batch and continuous mode are packed with the appropriate high performance silica separation phase. For low-pressure chromatography columns up to 80 cm diameter are available. Solvent delivery is ensured from eluent tank farms and containers.
The control of microbiological contamination is a prerequisite for API manufacturing. Class D (ISO 8) and C (ISO 7) clean rooms are supplied via HEPA-filtered, temperature and humidity controlled air, down-flow booths are used for minimizing microbial contamination and protecting operators. Highly active pharmaceutical ingredients are handled in integrated safety workbenches or flexible isolators reaching OEB level 4 (1-10 µg/m3).
Predefined physicochemical properties of the API can only be achieved by a carefully controlled isolation process. Besides precipitation and crystallization, lyophilization of intermediates and final API is a standard unit operation.  LaixingPharma have multiple lyophilizers in different sizes (up to 300 liters) located in clean rooms.


High Purity Ll-37 5mg (CAP-18) CAS 154947-66-7 Raw Powder Peptide


Small molecule manufacturing

ZhaoboBio's Peptide Plant also manufactures and offers a range of specialized services for the cGMP Small Molecules.
Small molecule production capabilities include: process development, chiral synthesis, heterocyclic chemistry, metal-catalyzed reactions, hydrogenations, oxidations and reductions using various reagents, enzymatic reactions, and high pressure reactions.


High Purity Ll-37 5mg (CAP-18) CAS 154947-66-7 Raw Powder Peptide


High Purity Ll-37 5mg (CAP-18) CAS 154947-66-7 Raw Powder PeptideHigh Purity Ll-37 5mg (CAP-18) CAS 154947-66-7 Raw Powder Peptide

 

Send your message to this supplier

*From:
*To:
*Message:

Enter between 20 to 4,000 characters.

This is not what you are looking for? Post a Sourcing Request Now
Contact Supplier