• Hot Sales Cosmetic Grade 99% Pure Ll-37 Peptide with Fast Shipping
  • Hot Sales Cosmetic Grade 99% Pure Ll-37 Peptide with Fast Shipping
  • Hot Sales Cosmetic Grade 99% Pure Ll-37 Peptide with Fast Shipping
  • Hot Sales Cosmetic Grade 99% Pure Ll-37 Peptide with Fast Shipping
  • Hot Sales Cosmetic Grade 99% Pure Ll-37 Peptide with Fast Shipping
  • Hot Sales Cosmetic Grade 99% Pure Ll-37 Peptide with Fast Shipping

Hot Sales Cosmetic Grade 99% Pure Ll-37 Peptide with Fast Shipping

CAS No.: 154947-66-7
Formula: C205h340n60o53
EINECS: /
Type: Lyophilized Powder
Appearance: Powder
Quality: Pharmaceutical Grade
Samples:
US$ 0/box 1 box(Min.Order)
| Request Sample
Customization:
Diamond Member Since 2023

Suppliers with verified business licenses

Zhejiang, China
High Repeat Buyers Choice
More than 50% of buyers repeatedly choose the supplier
to see all verified strength labels (12)
  • Overview
  • Product Description
  • Main Products
  • Services
Overview

Basic Info.

Model NO.
154947-66-7
Colour
White
Purity HPLC
≥99.0%
Sequence
[LL-37, 37 aa]
Molecular Weight
4 493.4
Storage
-20°c, Protect From Light, Dry, Sealed
Transport Package
Vials/Tubes/Bottles
Specification
5mg
Trademark
ZB
Origin
China
Production Capacity
100, 000 Vials Per Week

Product Description

Product Description

What is LL 37?

LL 37 Peptide, also known as CAP-18 for Cathelicidin antimicrobial peptide 18, is a 37 amino acid cationic peptide. LL37 is also a typical linear antimicrobial peptide which can eliminate a wide range of pathogenes, including bacteria, viruses, fungi, and parasites. CAP-18 is the only human cathelicidin peptide reported yet, found in lysosomes of macrophages and leukocytes.

LL 37- Technical SpecificationHot Sales Cosmetic Grade 99% Pure Ll-37 Peptide with Fast Shipping

  Sequence : [LL-37, 37 aa]
  MW : 4 493.4 Da (C205H340N60O53)
  Purity : > 99%
  Other names : Cathelicidin,154947-66-7, All38 peptide, BAC4, CAP18, CAMP, 
  Peptide Solubility Guideline
  Bulk peptide quantities available
 

What is the Benefit of LL-37 Peptide?

1. Immune Support
2. Antimicrobial Properties
3. Wound Healing
4. Anti-inflammatory Effects
5. Angiogenesis Promotion 
6. Anti-tumor Potential
7. Skin Health
8. Neuroprotective Effects
Hot Sales Cosmetic Grade 99% Pure Ll-37 Peptide with Fast Shipping
Hot Sales Cosmetic Grade 99% Pure Ll-37 Peptide with Fast Shipping

 
Main Products

GENERIC PEPTIDES (GMP)

# Product Sequence Therapeutic Area Form Unit Size
4109712 Semaglutide
CAS No.: 910463-68-2
H-His-Aib-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Gly-Gln-Ala-Ala-Lys(AEEAc-AEEAc-γ-Glu-carboxyheptadecanoyl)-Glu-Phe-Ile-Ala-Trp-Leu-Val-Arg-Gly-Arg-Gly-OH Type II diabetes mellitus
Obesity
Lyophilized powder 2 mg/vial
5 mg/vial
10 mg/vial
15 mg/vial
20 mg/vial
1 g/tube
4109713 Tirzepatide
CAS No.: 2023788-19-2
H-Tyr-{Aib}-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Tyr-Ser-Ile-{Aib}-Leu-Asp-Lys-Ile-Ala-Gln-{diacid-gamma-Glu-(AEEA)2-Lys}-Ala-Phe-Val-Gln-Trp-Leu-Ile-Ala-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Pro-Ser-NH2 Type II diabetes mellitus
Obesity
Lyophilized powder 10 mg/vial
15 mg/vial
20 mg/vial
30 mg/vial
60 mg/vial
1 g/tube
4109714 Cagrilintide
CAS No.: 1415456-99-3
{Eicosanedioic acid-γ-Glu}-Lys-Cys-Asn-Thr-Ala-Thr-Cys-Ala-Thr-Gln-Arg-Leu-Ala-Glu-Phe-Leu-Arg-His-Ser-Ser-Asn-Asn-Phe-Gly-Pro-Ile-Leu-Pro-Pro-Thr-Asn-Val-Gly-Ser-Asn-Thr-Pro-NH2 Type II diabetes mellitus
Obesity
Lyophilized powder 5 mg/vial
10 mg/vial
1 g/tube
4109715 CagriSema Blend Type II diabetes mellitus
Obesity
Lyophilized powder 5 mg/vial
10 mg/vial
20 mg/vial
1 g/tube
4109716 Retatrutide
CAS No. 2381089-83-2
Tyr-{Aib}-Gln-Gly-Thr-Phe-Thr-Ser-Asp-Tyr-Ser-Ile-{α-Me-Leu}-Leu-Asp-Lys-{diacid-C20-gamma-Glu-(AEEA)-Lys}-Ala-Gln-{Aib}-Ala-Phe-Ile-Glu-Tyr-Leu-Leu-Glu-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Pro-Ser-NH2 Treatment of type 2 diabetes
Treatment of obesity
Lyophilized powder 8 mg
10 mg
12 mg
15 mg
1 g/tube

 

Hot Sales Cosmetic Grade 99% Pure Ll-37 Peptide with Fast Shipping
Services

 

cGMP peptides Manufacturing

Zhaobo Bio acquired early mastery of development and manufacturing of peptides, the short chain amino acids linked by peptide bonds that have enabled new generations of small molecule drugs that closely mimic the body's natural pathways.
Now Zhaobo Bio possesses first-class capabilities to manufacture peptides at industrial scale and in full compliance with the strictest Good Manufacturing Practice (cGMP) standards.


Upstream peptide synthesis
Zhaobo Bio production plants are endowed with state-of-the-art equipment for solvent supply, peptide synthesis, purification and isolation of active ingredients and intermediates. All equipment and containment is GMP qualified and cleaning validated. Overlapping capacities and sizes of different equipment trains facilitate a smooth scale-up for increases in demand within the product life cycle. 

Downstream purification and isolation of peptides
Zhaobo Bio is committed to the systematic expansion and modernization of its purification equipment in order to ensure the efficient production of ever-increasing amounts of bulk peptide pharmaceuticals.
It uses sophisticated methods for large scale purification campaigns such as preparative high performance liquid chromatography (HPLC), ion exchange (IEX), size-exclusion chromatography (SEC), and ultra-filtration (UF/TFF). The equipment in place permits highly efficient or even continuous manufacturing of extremely pure products up to multi-kg quantities per lot.
For preparative HPLC, dynamic axial compression (DAC) stainless steel columns of up to 60 cm diameter both in batch and continuous mode are packed with the appropriate high performance silica separation phase. For low-pressure chromatography columns up to 80 cm diameter are available. Solvent delivery is ensured from eluent tank farms and containers.
The control of microbiological contamination is a prerequisite for API manufacturing. Class D (ISO 8) and C (ISO 7) clean rooms are supplied via HEPA-filtered, temperature and humidity controlled air, down-flow booths are used for minimizing microbial contamination and protecting operators. Highly active pharmaceutical ingredients are handled in integrated safety workbenches or flexible isolators reaching OEB level 4 (1-10 µg/m3).
Predefined physicochemical properties of the API can only be achieved by a carefully controlled isolation process. Besides precipitation and crystallization, lyophilization of intermediates and final API is a standard unit operation.  LaixingPharma have multiple lyophilizers in different sizes (up to 300 liters) located in clean rooms.


Hot Sales Cosmetic Grade 99% Pure Ll-37 Peptide with Fast Shipping


Small molecule manufacturing

ZhaoboBio's Peptide Plant also manufactures and offers a range of specialized services for the cGMP Small Molecules.
Small molecule production capabilities include: process development, chiral synthesis, heterocyclic chemistry, metal-catalyzed reactions, hydrogenations, oxidations and reductions using various reagents, enzymatic reactions, and high pressure reactions.


Hot Sales Cosmetic Grade 99% Pure Ll-37 Peptide with Fast Shipping


Hot Sales Cosmetic Grade 99% Pure Ll-37 Peptide with Fast ShippingHot Sales Cosmetic Grade 99% Pure Ll-37 Peptide with Fast Shipping

 

Send your message to this supplier

*From:
*To:
*Message:

Enter between 20 to 4,000 characters.

This is not what you are looking for? Post a Sourcing Request Now

You Might Also Like

Diamond Member Since 2023

Suppliers with verified business licenses

Manufacturer/Factory
Registered Capital
70000000 RMB
Management System Certification
ISO 9001, ISO 14001, ISO 20000, GMP, HACCP, FSC