High Purity Cosmetic Grade Ll-37 Peptide Raw Material Peptide CAS 154947-66-7

• Customization: Available
• CAS No.: 154947-66-7
• Formula: C205h340n60o53
• Model NO.: 154947-66-7
• Type: Lyophilized Powder
• Appearance: Powder
• Quality: Pharmaceutical Grade
• Colour: White
• Purity: > 99%HPLC
• Relative Molecular Mass: 4493.4 G/Mol
• Delivery Time: Within 24 Hours After Payment
• Arrival Time: 9-14days
• Transport Package: Vials/Tubes/Bottles
• Specification: 5mg
• Trademark: ZB
• Origin: China
• Production Capacity: 100, 000 Vials Per Month

Product Description

Product Description

What is LL 37?

LL-37 is a cathelicidin which helps to regulate bacteria and virus invasion, as well as control infections. As per research, AMPs such as this one can be used in research to activate the innate mucosal immune response to remove infections.

The peptide LL 37 is released as a mature peptide when a type of white blood cell known as neutrophils are stimulated. It then expresses itself in various cells and tissues such as bone marrow cells, circulating neutrophils, gastrointestinal tract cells, the lungs, and the cells in the skin as research on animals has shown.

Scientific investigations show that vitamin D released through the skin stimulates the production of LL-37. Additional studies suggest that ll37 peptide plays a significant role in the defense against infection at sites of wounds and inflammation. In fact, it is toxic to both bacterial and normal cells.

The ll-37 sequence is: -Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser.

LL 37- Technical Specification

	Sequence : [LL-37, 37 aa]
	MW : 4 493.4 Da (C205H340N60O53)
	Purity : > 99%
	Other names : Cathelicidin,154947-66-7, All38 peptide, BAC4, CAP18, CAMP,
	Peptide Solubility Guideline
	Bulk peptide quantities available

What is the Benefit of LI 37 Peptide?

1. Immune Support
2. Antimicrobial Properties
3. Wound Healing
4. Anti-inflammatory Effects
5. Angiogenesis Promotion 
6. Anti-tumor Potential
7. Skin Health
8. Neuroprotective Effects

 

 

Our Advantages: High purity, Wholesale price, large stock, Stealth Shipping, 100% Delivery Guarantee

 

 

Our advantages:

Goods quality

1. Product has COA, and HPLC report
2. Our factory is ISO9001 standard
3. We get good feedback from customers around the world 

OEM service

1. Add customer's logo
2. Redesign label, packing box as customer's requirement
3. Cap color can be customized

Shipping service

1. Goods shipped in 2-7 days after get payment.
2. Small order ship by express door to door.
3. Goods arrive in 7-20 days

24 hours on-time response

1. Reply your inquiry within 12 hours
2. Keep tracking goods and update information to customer
3. After-sale service anytime

Company

 

Zhaobo Bio acquired early mastery of development and manufacturing of peptides, the short chain amino acids linked by peptide bonds that have enabled new generations of small molecule drugs that closely mimic the body's natural pathways.
Now Zhaobo Bio possesses first-class capabilities to manufacture peptides at industrial scale and in full compliance with the strictest Good Manufacturing Practice (cGMP) standards.

Upstream peptide synthesis
Zhaobo Bio production plants are endowed with state-of-the-art equipment for solvent supply, peptide synthesis, purification and isolation of active ingredients and intermediates. All equipment and containment is GMP qualified and cleaning validated. Overlapping capacities and sizes of different equipment trains facilitate a smooth scale-up for increases in demand within the product life cycle. 

Downstream purification and isolation of peptides
Zhaobo Bio is committed to the systematic expansion and modernization of its purification equipment in order to ensure the efficient production of ever-increasing amounts of bulk peptide pharmaceuticals.
It uses sophisticated methods for large scale purification campaigns such as preparative high performance liquid chromatography (HPLC), ion exchange (IEX), size-exclusion chromatography (SEC), and ultra-filtration (UF/TFF). The equipment in place permits highly efficient or even continuous manufacturing of extremely pure products up to multi-kg quantities per lot.
For preparative HPLC, dynamic axial compression (DAC) stainless steel columns of up to 60 cm diameter both in batch and continuous mode are packed with the appropriate high performance silica separation phase. For low-pressure chromatography columns up to 80 cm diameter are available. Solvent delivery is ensured from eluent tank farms and containers.
The control of microbiological contamination is a prerequisite for API manufacturing. Class D (ISO 8) and C (ISO 7) clean rooms are supplied via HEPA-filtered, temperature and humidity controlled air, down-flow booths are used for minimizing microbial contamination and protecting operators. Highly active pharmaceutical ingredients are handled in integrated safety workbenches or flexible isolators reaching OEB level 4 (1-10 µg/m3).
Predefined physicochemical properties of the API can only be achieved by a carefully controlled isolation process. Besides precipitation and crystallization, lyophilization of intermediates and final API is a standard unit operation.  LaixingPharma have multiple lyophilizers in different sizes (up to 300 liters) located in clean room

Packaging & Shipping