• High Purity Cosmetic Grade Ll-37 Peptide Raw Material Peptide CAS 154947-66-7
  • High Purity Cosmetic Grade Ll-37 Peptide Raw Material Peptide CAS 154947-66-7
  • High Purity Cosmetic Grade Ll-37 Peptide Raw Material Peptide CAS 154947-66-7
  • High Purity Cosmetic Grade Ll-37 Peptide Raw Material Peptide CAS 154947-66-7
  • High Purity Cosmetic Grade Ll-37 Peptide Raw Material Peptide CAS 154947-66-7
  • High Purity Cosmetic Grade Ll-37 Peptide Raw Material Peptide CAS 154947-66-7

High Purity Cosmetic Grade Ll-37 Peptide Raw Material Peptide CAS 154947-66-7

CAS No.: 154947-66-7
Formula: C205h340n60o53
EINECS: /
Type: Lyophilized Powder
Appearance: Powder
Quality: Pharmaceutical Grade
Samples:
US$ 0/box 1 box(Min.Order)
| Request Sample
Customization:
Diamond Member Since 2023

Suppliers with verified business licenses

Zhejiang, China
High Repeat Buyers Choice
More than 50% of buyers repeatedly choose the supplier
to see all verified strength labels (12)
  • Overview
  • Product Description
  • Main Products
  • Company
  • Packaging & Shipping
Overview

Basic Info.

Model NO.
154947-66-7
Colour
White
Purity
> 99%HPLC
Relative Molecular Mass
4493.4 G/Mol
Delivery Time
Within 24 Hours After Payment
Arrival Time
9-14days
Transport Package
Vials/Tubes/Bottles
Specification
5mg
Trademark
ZB
Origin
China
Production Capacity
100, 000 Vials Per Month

Product Description

Product Description

What is LL 37?

LL-37 is a cathelicidin which helps to regulate bacteria and virus invasion, as well as control infections. As per research, AMPs such as this one can be used in research to activate the innate mucosal immune response to remove infections.

The peptide LL 37 is released as a mature peptide when a type of white blood cell known as neutrophils are stimulated. It then expresses itself in various cells and tissues such as bone marrow cells, circulating neutrophils, gastrointestinal tract cells, the lungs, and the cells in the skin as research on animals has shown.

Scientific investigations show that vitamin D released through the skin stimulates the production of LL-37. Additional studies suggest that ll37 peptide plays a significant role in the defense against infection at sites of wounds and inflammation. In fact, it is toxic to both bacterial and normal cells.

The ll-37 sequence is: -Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser.

LL 37- Technical Specification

  Sequence : [LL-37, 37 aa]
  MW : 4 493.4 Da (C205H340N60O53)
  Purity : > 99%
  Other names : Cathelicidin,154947-66-7, All38 peptide, BAC4, CAP18, CAMP, 
  Peptide Solubility Guideline
  Bulk peptide quantities available

What is the Benefit of LI 37 Peptide?

1. Immune Support
2. Antimicrobial Properties
3. Wound Healing
4. Anti-inflammatory Effects
5. Angiogenesis Promotion 
6. Anti-tumor Potential
7. Skin Health
8. Neuroprotective Effects
High Purity Cosmetic Grade Ll-37 Peptide Raw Material Peptide CAS 154947-66-7

 
Main Products
Product No. Product
45051511 Semaglutide 5mg
45051512 Semaglutide 10mg
45051513 Semaglutide+Vitamin B12
45051514 Semaglutide+Vitamin B6
45051515 Semaglutide+L-Carnitine
45051516 Semaglutide cartridges 5mg
45051517 Semaglutide cartridges 10mg
45051518 Setmelanotide 20mg
45051519 Tirzepatide 5mg
45051520 Tirzepatide 10mg
45051521 Tirzepatide 15mg
45051522 Tirzepatide 20mg
45051523 Tirzepatide 30mg
45051524 Tirzepatide+Vitamin B12
45051525 Liraglutide 10g
45051526 Retatrutide 8mg
45051527 Retatrutide 10mg
45051528 Retatrutide 12mg
45051529 Orforglipron 1g
45051530 Mazdutide 1g
45051531 NAD+ 500mg
45051532 NAD+ 750mg
45051533 NAD+ 1000mg
45051534 NMN 150mg
45051538 Adipotide/FTPP 10mg
45051539 α-Klotho (Alpha Klotho) 50µg
45051541 A960 5mg
45051542 ARA-290 16mg
45051543 57 5mg
45051544 57 10mg
45051545 B7-33 5mg
45051546 cAC-253 (Cyclic AC-253) 10mg
45051549 DSIP 5mg
45051550 DSIP 10mg
45051551 Epitalon 10mg
45051552 Epitalon 20mg
45051553 Epitalon 100mg
45051554 FG loop (FGL) 10mg
45051556 F344 1mg
45051557 FOXO4-DRI 10mg
45051559 GHK-Cu (Copper Peptide) 50mg
45051560 GHK-Cu (Copper Peptide) 100mg
45051561 G2 10mg
45051562 G6 10mg
45051563 Gona 10mg
45051564 HC5000
45051565 Hexa 2mg
45051566 Hexa 5mg
45051568 Humanin 10mg
45051573 Ipam 5mg
45051575 Kisspeptin-10 5mg
45051576 Kisspeptin-10 10mg
45051577 KPV 5mg
45051578 KPV 10mg
45051579 LL-37 (CAP-18) 5mg
45051580 Melanotan 1 10mg
45051581 Melanotan 2 10mg
45051582 MOTS-c 5mg (acetate, TFA removed)
45051583 MOTS-c 10mg  (acetate, TFA removed)
45051584 N-Acetyl Epitalon Amidate 10mg
45051585 N-Acetyl Selank Amidate 10mg
45051586 N-Acetyl Semax Amidate 30mg
45051587 Oxytocin 10mg
45051588 PNC-27 5mg
45051590 P21 (P021) 5mg
45051591 Selank 10mg
45051592 Semax 10mg
45051593 Sermo 2mg
45051594 Sermo 5mg
45051595 SS-31 40mg
45051596 Taltirelin 10mg
45051597 Tesam 2mg
45051598 Tesam 5mg
45051600 Thymalin 20mg (63958-90-7)
45051601 Thymosin Alpha-1 3mg
45051602 Thymosin Alpha-1 5mg
45051603 Thymosin Alpha-1 10mg
45051604 Thymosinb4 5mg
45051605 Thymosinb4 10mg
45051607 TP508 Thrombin Peptide 10mg
45051608 TRH Thyrotropin (Protirelin Acetate) 20mg
45051609 VIP (Vasoactive Intestinal Peptide) 6mg
45051610 Bronchogen (Bronchi) 20mg
45051611 Cardiogen (Myocardium) 20mg
45051612 Cartalax (Joints) 20mg
45051613 Chonluten (Respiratory organs) 20mg
45051614 Cortagen (Brain) 20mg
45051615 Crystagen (Immune system) 20mg
45051616 Livagen (Liver) 20mg
45051617 Pancragen (Pancreas) 20mg
45051618 Pinealon (Brain) 20mg
45051619 Prostamax (Prostate) 20mg
45051620 Testagen (Testes) 20mg
45051621 Vesugen (Blood vessels) 20mg
45051622 Vilon (Eye retina) 20mg
45051623 B15, T50 Blend 10mg
 
 
High Purity Cosmetic Grade Ll-37 Peptide Raw Material Peptide CAS 154947-66-7

Our Advantages: High purity, Wholesale price, large stock, Stealth Shipping, 100% Delivery Guarantee

High Purity Cosmetic Grade Ll-37 Peptide Raw Material Peptide CAS 154947-66-7
High Purity Cosmetic Grade Ll-37 Peptide Raw Material Peptide CAS 154947-66-7
High Purity Cosmetic Grade Ll-37 Peptide Raw Material Peptide CAS 154947-66-7
High Purity Cosmetic Grade Ll-37 Peptide Raw Material Peptide CAS 154947-66-7
 
High Purity Cosmetic Grade Ll-37 Peptide Raw Material Peptide CAS 154947-66-7
High Purity Cosmetic Grade Ll-37 Peptide Raw Material Peptide CAS 154947-66-7
High Purity Cosmetic Grade Ll-37 Peptide Raw Material Peptide CAS 154947-66-7
 


Our advantages:

Goods quality

  1. Product has COA, and HPLC report
  2. Our factory is ISO9001 standard
  3. We get good feedback from customers around the world 
OEM service
  1. Add customer's logo
  2. Redesign label, packing box as customer's requirement
  3. Cap color can be customized
Shipping service
  1. Goods shipped in 2-7 days after get payment.
  2. Small order ship by express door to door.
  3. Goods arrive in 7-20 days
24 hours on-time response
  1. Reply your inquiry within 12 hours
  2. Keep tracking goods and update information to customer
  3. After-sale service anytime
Company

 

High Purity Cosmetic Grade Ll-37 Peptide Raw Material Peptide CAS 154947-66-7
Zhaobo Bio acquired early mastery of development and manufacturing of peptides, the short chain amino acids linked by peptide bonds that have enabled new generations of small molecule drugs that closely mimic the body's natural pathways.
Now Zhaobo Bio possesses first-class capabilities to manufacture peptides at industrial scale and in full compliance with the strictest Good Manufacturing Practice (cGMP) standards.


Upstream peptide synthesis
Zhaobo Bio production plants are endowed with state-of-the-art equipment for solvent supply, peptide synthesis, purification and isolation of active ingredients and intermediates. All equipment and containment is GMP qualified and cleaning validated. Overlapping capacities and sizes of different equipment trains facilitate a smooth scale-up for increases in demand within the product life cycle. 

Downstream purification and isolation of peptides
Zhaobo Bio is committed to the systematic expansion and modernization of its purification equipment in order to ensure the efficient production of ever-increasing amounts of bulk peptide pharmaceuticals.
It uses sophisticated methods for large scale purification campaigns such as preparative high performance liquid chromatography (HPLC), ion exchange (IEX), size-exclusion chromatography (SEC), and ultra-filtration (UF/TFF). The equipment in place permits highly efficient or even continuous manufacturing of extremely pure products up to multi-kg quantities per lot.
For preparative HPLC, dynamic axial compression (DAC) stainless steel columns of up to 60 cm diameter both in batch and continuous mode are packed with the appropriate high performance silica separation phase. For low-pressure chromatography columns up to 80 cm diameter are available. Solvent delivery is ensured from eluent tank farms and containers.
The control of microbiological contamination is a prerequisite for API manufacturing. Class D (ISO 8) and C (ISO 7) clean rooms are supplied via HEPA-filtered, temperature and humidity controlled air, down-flow booths are used for minimizing microbial contamination and protecting operators. Highly active pharmaceutical ingredients are handled in integrated safety workbenches or flexible isolators reaching OEB level 4 (1-10 µg/m3).
Predefined physicochemical properties of the API can only be achieved by a carefully controlled isolation process. Besides precipitation and crystallization, lyophilization of intermediates and final API is a standard unit operation.  LaixingPharma have multiple lyophilizers in different sizes (up to 300 liters) located in clean room
High Purity Cosmetic Grade Ll-37 Peptide Raw Material Peptide CAS 154947-66-7
High Purity Cosmetic Grade Ll-37 Peptide Raw Material Peptide CAS 154947-66-7

Packaging & Shipping

High Purity Cosmetic Grade Ll-37 Peptide Raw Material Peptide CAS 154947-66-7High Purity Cosmetic Grade Ll-37 Peptide Raw Material Peptide CAS 154947-66-7

FAQ

1. How to preserve peptides after receiving them?

Peptides in the form of lyophilized powder can be transported at room temperature by vacuum packaging, while polypeptides in the dissolved state need to be refrigerated at 2°C - 8°C. For long-term storage, peptides should be stored in the form of lyophilized powder stored at -20°C or -80°C in a sealed container with desiccant, which can avoid the degradation of peptides to the greatest extent.
 

2. What is your lead time and shipping method?
Customized items are negotiable. 1-3 working day after payment arranges the shipping. Parcels shipping by sea, by air, or by express (EMS, UPS, DHL, TNT, FEDEX, etc).
 
3. Is the shipping 100% Guarantee?
Yes, we offer 100% Shipping Guarantee. If any seized parcel we will do resending. 

4. What payment methods do you support?
T/T, Western Union, bank transfer, BTC, USDT and Alibaba payment, this is negotiable. If you use Alibaba and PayPay payment, you need to pay an additional service fee, please understand.


5. Will I have any side effects after using peptide?
If you just begin to use, it is better to follow doctor's prescription. And if there is no allergy or any uncomfortable symptom, you can continue to use but take it in a suitable dosage. A few people will have slight allergy reaction, but after your body get used to it, the allergy will be disappear and back to normal.

Send your message to this supplier

*From:
*To:
*Message:

Enter between 20 to 4,000 characters.

This is not what you are looking for? Post a Sourcing Request Now

You Might Also Like

Diamond Member Since 2023

Suppliers with verified business licenses

Manufacturer/Factory
Registered Capital
70000000 RMB
Management System Certification
ISO 9001, ISO 14001, ISO 20000, GMP, HACCP, FSC