| Customization: | Available |
|---|---|
| Purity: | > 99%HPLC |
| Relative Molecular Mass: | 4493.4 G/Mol |
|
Still deciding? Get samples of US$ 0/box
Request Sample
|
Suppliers with verified business licenses
Audited Supplier Audited by an independent third-party inspection agency
What is LL 37?
LL-37 is a cathelicidin which helps to regulate bacteria and virus invasion, as well as control infections. As per research, AMPs such as this one can be used in research to activate the innate mucosal immune response to remove infections.
The peptide LL 37 is released as a mature peptide when a type of white blood cell known as neutrophils are stimulated. It then expresses itself in various cells and tissues such as bone marrow cells, circulating neutrophils, gastrointestinal tract cells, the lungs, and the cells in the skin as research on animals has shown.
Scientific investigations show that vitamin D released through the skin stimulates the production of LL-37. Additional studies suggest that ll37 peptide plays a significant role in the defense against infection at sites of wounds and inflammation. In fact, it is toxic to both bacterial and normal cells.
The ll-37 sequence is: -Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser.
LL 37- Technical Specification
| Sequence : [LL-37, 37 aa] | |
| MW : 4 493.4 Da (C205H340N60O53) | |
| Purity : > 99% | |
| Other names : Cathelicidin,154947-66-7, All38 peptide, BAC4, CAP18, CAMP, | |
| Peptide Solubility Guideline | |
| Bulk peptide quantities available |
1. Immune Support
2. Antimicrobial Properties
3. Wound Healing
4. Anti-inflammatory Effects
5. Angiogenesis Promotion
6. Anti-tumor Potential
7. Skin Health
8. Neuroprotective Effects
Our Advantages: High purity, Wholesale price, large stock, Stealth Shipping, 100% Delivery Guarantee
Our advantages:
Goods quality
Upstream peptide synthesis
Zhaobo Bio production plants are endowed with state-of-the-art equipment for solvent supply, peptide synthesis, purification and isolation of active ingredients and intermediates. All equipment and containment is GMP qualified and cleaning validated. Overlapping capacities and sizes of different equipment trains facilitate a smooth scale-up for increases in demand within the product life cycle.
Downstream purification and isolation of peptides
Zhaobo Bio is committed to the systematic expansion and modernization of its purification equipment in order to ensure the efficient production of ever-increasing amounts of bulk peptide pharmaceuticals.
It uses sophisticated methods for large scale purification campaigns such as preparative high performance liquid chromatography (HPLC), ion exchange (IEX), size-exclusion chromatography (SEC), and ultra-filtration (UF/TFF). The equipment in place permits highly efficient or even continuous manufacturing of extremely pure products up to multi-kg quantities per lot.
For preparative HPLC, dynamic axial compression (DAC) stainless steel columns of up to 60 cm diameter both in batch and continuous mode are packed with the appropriate high performance silica separation phase. For low-pressure chromatography columns up to 80 cm diameter are available. Solvent delivery is ensured from eluent tank farms and containers.
The control of microbiological contamination is a prerequisite for API manufacturing. Class D (ISO 8) and C (ISO 7) clean rooms are supplied via HEPA-filtered, temperature and humidity controlled air, down-flow booths are used for minimizing microbial contamination and protecting operators. Highly active pharmaceutical ingredients are handled in integrated safety workbenches or flexible isolators reaching OEB level 4 (1-10 µg/m3).
Predefined physicochemical properties of the API can only be achieved by a carefully controlled isolation process. Besides precipitation and crystallization, lyophilization of intermediates and final API is a standard unit operation. LaixingPharma have multiple lyophilizers in different sizes (up to 300 liters) located in clean room
){kind=link}