Pnc-27 Vials Synthesis Peptide 99% Purity Pnc-27 P21 P021 Mots-C Ara 290 Ll-37 Adipotide Ftpp B7-33

Product Details
Customization: Available
Peptide Purity: >99%
Delivery Time: Within 24 Hours After Payment
Still deciding? Get samples of US$ 50/Vial/Tube
Request Sample
Diamond Member Since 2023

Suppliers with verified business licenses

Audited Supplier

Audited by an independent third-party inspection agency

High Repeat Buyers Choice
More than 50% of buyers repeatedly choose the supplier
to see all verified strength labels (12)
  • Pnc-27 Vials Synthesis Peptide 99% Purity Pnc-27 P21 P021 Mots-C Ara 290 Ll-37 Adipotide Ftpp B7-33
  • Pnc-27 Vials Synthesis Peptide 99% Purity Pnc-27 P21 P021 Mots-C Ara 290 Ll-37 Adipotide Ftpp B7-33
  • Pnc-27 Vials Synthesis Peptide 99% Purity Pnc-27 P21 P021 Mots-C Ara 290 Ll-37 Adipotide Ftpp B7-33
  • Pnc-27 Vials Synthesis Peptide 99% Purity Pnc-27 P21 P021 Mots-C Ara 290 Ll-37 Adipotide Ftpp B7-33
  • Pnc-27 Vials Synthesis Peptide 99% Purity Pnc-27 P21 P021 Mots-C Ara 290 Ll-37 Adipotide Ftpp B7-33
  • Pnc-27 Vials Synthesis Peptide 99% Purity Pnc-27 P21 P021 Mots-C Ara 290 Ll-37 Adipotide Ftpp B7-33
Find Similar Products
  • Overview
  • Product Description
  • Company Profile
  • Feedback
Overview

Basic Info.

Model NO.
1159861-00-3
Name
Pnc-27
CAS Number
1159861-00-3
Molecular Formula
C188h293n53o44s
Molecular Weight
4031.73
Stock
in Stock
Transport Package
Vials/Tube
Specification
10mg, 1g
Trademark
ZB
Origin
China
Production Capacity
1-5kgs Per Month

Product Description

   Pnc-27 Vials Synthesis Peptide 99% Purity Pnc-27 P21 P021 Mots-C Ara 290 Ll-37 Adipotide Ftpp B7-33

Product Description

Our Advantages: High purity, Wholesale price, large stock, Stealth Shipping, 100% Delivery Guarantee
Pnc-27 Vials Synthesis Peptide 99% Purity Pnc-27 P21 P021 Mots-C Ara 290 Ll-37 Adipotide Ftpp B7-33
Detailed Product Information
 PNC-27 is an anticancer peptide, containing an HDM-2-binding domain. PNC-27 shows anti-tumor activity and can be used in acute myeloid leukemia research.
CAS 1159861-00-3
M.W/Mr. 4029.2
Purity 99%
Sequence PPLSQETFSDLWKLLKKWKMRRNQFWVKVQRG

 

 

Pnc-27 Vials Synthesis Peptide 99% Purity Pnc-27 P21 P021 Mots-C Ara 290 Ll-37 Adipotide Ftpp B7-33
Pnc-27 Vials Synthesis Peptide 99% Purity Pnc-27 P21 P021 Mots-C Ara 290 Ll-37 Adipotide Ftpp B7-33
Pnc-27 Vials Synthesis Peptide 99% Purity Pnc-27 P21 P021 Mots-C Ara 290 Ll-37 Adipotide Ftpp B7-33
Pnc-27 Vials Synthesis Peptide 99% Purity Pnc-27 P21 P021 Mots-C Ara 290 Ll-37 Adipotide Ftpp B7-33
Pnc-27 Vials Synthesis Peptide 99% Purity Pnc-27 P21 P021 Mots-C Ara 290 Ll-37 Adipotide Ftpp B7-33
Pnc-27 Vials Synthesis Peptide 99% Purity Pnc-27 P21 P021 Mots-C Ara 290 Ll-37 Adipotide Ftpp B7-33
Pnc-27 Vials Synthesis Peptide 99% Purity Pnc-27 P21 P021 Mots-C Ara 290 Ll-37 Adipotide Ftpp B7-33
Pnc-27 Vials Synthesis Peptide 99% Purity Pnc-27 P21 P021 Mots-C Ara 290 Ll-37 Adipotide Ftpp B7-33

Company Profile

ZB Bio has a long-standing track record in with successful registrations of highly purified synthetic peptide drugs of the glucagon family. Our regulatory intelligence keeps track of important changes in the relevant legislation. This enables us to be a leading global innovator in the field of glucagon and glucagon-like synthetic peptide drugs. Our services have been optimized to shorten timelines and of reduce complexity for our clients.

Our high-tech Good Manufacturing Practice (GMP) facilities based in Zhejiang province china, plus the commitment of our technical and scientific experts to quality, are the cornerstones for continuous compliance. We deliver small-scale to multi-kg active pharmaceutical ingredients (APIs) with impurities below 0.5%, identification and characterization of impurities above 0.10% using orthogonal analytical techniques.

OPTIMIZED, AUTOMATED HIGH-YIELD PRODUCTION

Our long experience in complex APIs allows us to optimize the processes for high yields at outstanding quality. Our high level of process automation allows for cost-efficient and large-scale production resulting in excellent overall material purity (>99.5%). Innovative solutions like continuous chromatography let us use equipment and resources more efficiently and help us and our partners to achieve their commitment to sustainability and environment-friendly production.

OUR TIMELINES FOR SEMA

Pnc-27 Vials Synthesis Peptide 99% Purity Pnc-27 P21 P021 Mots-C Ara 290 Ll-37 Adipotide Ftpp B7-33

ROBUST PROCESSES AND SUPPLY SECURITY

Having our in-house building blocks for peptide synthesis as well as long-term cooperation with trusted suppliers ensures on-time production. Redundancy of multi-purpose equipment and facilities helps to mitigate risks in the supply chain, together with our stock of finished APIs and is the key for on-time product deliveries to our customers.

RELATED PRODUCTS (FOR RESEARCH PURPOSES ONLY)

Beyond GMP-grade sema, we provide sema in research grade, variants thereof and in different salt forms.

Pnc-27 Vials Synthesis Peptide 99% Purity Pnc-27 P21 P021 Mots-C Ara 290 Ll-37 Adipotide Ftpp B7-33Pnc-27 Vials Synthesis Peptide 99% Purity Pnc-27 P21 P021 Mots-C Ara 290 Ll-37 Adipotide Ftpp B7-33

 

Feedback

Pnc-27 Vials Synthesis Peptide 99% Purity Pnc-27 P21 P021 Mots-C Ara 290 Ll-37 Adipotide Ftpp B7-33Pnc-27 Vials Synthesis Peptide 99% Purity Pnc-27 P21 P021 Mots-C Ara 290 Ll-37 Adipotide Ftpp B7-33Pnc-27 Vials Synthesis Peptide 99% Purity Pnc-27 P21 P021 Mots-C Ara 290 Ll-37 Adipotide Ftpp B7-33Pnc-27 Vials Synthesis Peptide 99% Purity Pnc-27 P21 P021 Mots-C Ara 290 Ll-37 Adipotide Ftpp B7-33

Pnc-27 Vials Synthesis Peptide 99% Purity Pnc-27 P21 P021 Mots-C Ara 290 Ll-37 Adipotide Ftpp B7-33Pnc-27 Vials Synthesis Peptide 99% Purity Pnc-27 P21 P021 Mots-C Ara 290 Ll-37 Adipotide Ftpp B7-33Pnc-27 Vials Synthesis Peptide 99% Purity Pnc-27 P21 P021 Mots-C Ara 290 Ll-37 Adipotide Ftpp B7-33Pnc-27 Vials Synthesis Peptide 99% Purity Pnc-27 P21 P021 Mots-C Ara 290 Ll-37 Adipotide Ftpp B7-33

 

Send your message to this supplier

*From:
*To:
*Message:

Enter between 20 to 4,000 characters.

This is not what you are looking for? Post a Sourcing Request Now
Contact Supplier