Customization: | Available |
---|---|
Peptide Purity: | >99% |
Delivery Time: | Within 24 Hours After Payment |
Still deciding? Get samples of US$ 50/Vial/Tube
Request Sample
|
Suppliers with verified business licenses
Audited by an independent third-party inspection agency
CAS | 1159861-00-3 |
M.W/Mr. | 4029.2 |
Purity | 99% |
Sequence | PPLSQETFSDLWKLLKKWKMRRNQFWVKVQRG |
ZB Bio has a long-standing track record in with successful registrations of highly purified synthetic peptide drugs of the glucagon family. Our regulatory intelligence keeps track of important changes in the relevant legislation. This enables us to be a leading global innovator in the field of glucagon and glucagon-like synthetic peptide drugs. Our services have been optimized to shorten timelines and of reduce complexity for our clients.