Synthesis High Purity Pnc-27 P21 P021 Mots-C Ara 290 Ll-37 Adipotide Ftpp B7-33

• CAS No.: 1159861-00-3
• Formula: C188h293n53o44s
• EINECS: 307297-39-8
• Type: Pharmaceutical Intermediates
• Appearance: Powder
• Quality: Pharmaceutical Grade
• Model NO.: 1159861-00-3
• Colour: White
• Purity: Nlt 99%
• Sequence: Pplsqetfsdlwkllkkwkmrrnqfwvkvqrg
• Molecular Weight: 4029.2
• Synonyms: Epitalon, Epytalamin, Agag, Aedg
• Transport Package: Vials/Tube/Bottle
• Specification: 10mg, 15mg, 20mg, 25mg, 30mg, 1g
• Trademark: ZB
• Origin: China
• Production Capacity: 100, 000 Vials Per Month

Product Description

Product Description

PNC-27 is an anticancer peptide, containing an HDM-2-binding domain. PNC-27 shows anti-tumor activity and can be used in acute myeloid leukemia research.
 

CAS	1159861-00-3
M.W/Mr.	4029.2
Purity	99%
Sequence	PPLSQETFSDLWKLLKKWKMRRNQFWVKVQRG

Services

More Peptides

Product No.	Product
45051511	Semaglutide 5mg
45051512	Semaglutide 10mg
45051513	Semaglutide+Vitamin B12
45051514	Semaglutide+Vitamin B6
45051515	Semaglutide+L-Carnitine
45051516	Semaglutide cartridges 5mg
45051517	Semaglutide cartridges 10mg
45051518	Setmelanotide 20mg
45051519	Tirzepatide 5mg
45051520	Tirzepatide 10mg
45051521	Tirzepatide 15mg
45051522	Tirzepatide 20mg
45051523	Tirzepatide 30mg
45051524	Tirzepatide+Vitamin B12
45051525	Liraglutide 10g
45051526	Retatrutide 8mg
45051527	Retatrutide 10mg
45051528	Retatrutide 12mg
45051529	Orforglipron 1g
45051530	Mazdutide 1g
45051531	NAD+ 500mg
45051532	NAD+ 750mg
45051533	NAD+ 1000mg
45051534	NMN 150mg
45051538	Adipotide/FTPP 10mg
45051539	α-Klotho (Alpha Klotho) 50µg
45051541	A960 5mg
45051542	ARA-290 16mg
45051543	57 5mg
45051544	57 10mg
45051545	B7-33 5mg
45051546	cAC-253 (Cyclic AC-253) 10mg
45051549	DSIP 5mg
45051550	DSIP 10mg
45051551	Epitalon 10mg
45051552	Epitalon 20mg
45051553	Epitalon 100mg
45051554	FG loop (FGL) 10mg
45051556	F344 1mg
45051557	FOXO4-DRI 10mg
45051559	GHK-Cu (Copper Peptide) 50mg
45051560	GHK-Cu (Copper Peptide) 100mg
45051561	G2 10mg
45051562	G6 10mg
45051563	Gona 10mg
45051564	HC5000
45051565	Hexa 2mg
45051566	Hexa 5mg
45051568	Humanin 10mg
45051573	Ipam 5mg
45051575	Kisspeptin-10 5mg
45051576	Kisspeptin-10 10mg
45051577	KPV 5mg
45051578	KPV 10mg
45051579	LL-37 (CAP-18) 5mg
45051580	Melanotan 1 10mg
45051581	Melanotan 2 10mg
45051582	MOTS-c 5mg (acetate, TFA removed)
45051583	MOTS-c 10mg  (acetate, TFA removed)
45051584	N-Acetyl Epitalon Amidate 10mg
45051585	N-Acetyl Selank Amidate 10mg
45051586	N-Acetyl Semax Amidate 30mg
45051587	Oxytocin 10mg
45051588	PNC-27 5mg
45051590	P21 (P021) 5mg
45051591	Selank 10mg
45051592	Semax 10mg
45051593	Sermo 2mg
45051594	Sermo 5mg
45051595	SS-31 40mg
45051596	Taltirelin 10mg
45051597	Tesam 2mg
45051598	Tesam 5mg
45051600	Thymalin 20mg (63958-90-7)
45051601	Thymosin Alpha-1 3mg
45051602	Thymosin Alpha-1 5mg
45051603	Thymosin Alpha-1 10mg
45051604	Thymosinb4 5mg
45051605	Thymosinb4 10mg
45051607	TP508 Thrombin Peptide 10mg
45051608	TRH Thyrotropin (Protirelin Acetate) 20mg
45051609	VIP (Vasoactive Intestinal Peptide) 6mg
45051610	Bronchogen (Bronchi) 20mg
45051611	Cardiogen (Myocardium) 20mg
45051612	Cartalax (Joints) 20mg
45051613	Chonluten (Respiratory organs) 20mg
45051614	Cortagen (Brain) 20mg
45051615	Crystagen (Immune system) 20mg
45051616	Livagen (Liver) 20mg
45051617	Pancragen (Pancreas) 20mg
45051618	Pinealon (Brain) 20mg
45051619	Prostamax (Prostate) 20mg
45051620	Testagen (Testes) 20mg
45051621	Vesugen (Blood vessels) 20mg
45051622	Vilon (Eye retina) 20mg
45051623	B15, T50 Blend 10mg